PDB entry 6mzw

View 6mzw on RCSB PDB site
Description: TAS-120 covalent complex with FGFR1
Class: TRANSFERASE/Transferase Inhibitor
Keywords: FGFR1, TAS-120, inhibitor, complex, covalent, TRANSFERASE, TRANSFERASE-Transferase Inhibitor complex
Deposited on 2018-11-05, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-310)
      • conflict (129)
    Domains in SCOPe 2.07: d6mzwa_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mzwb_
  • Heterogens: TZ0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mzwA (A:)
    gamsgvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mzwA (A:)
    elpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
    synpspeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglp
    vkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkps
    nctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mzwB (B:)
    gamsgvseyelpedprwelprdrlvlgkplgegcfgqvvlaeaigldkdkpnrvtkvavk
    mlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylq
    arrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvted
    nvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweif
    tlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedl
    drivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mzwB (B:)
    yelpedprwelprdrlvlgkplgqvvlaeaigldkpnrvtkvavkmlksdatekdlsdli
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlsskdlvsca
    yqvargmeylaskkcihrdlaarnvlvtednvmkiadfpvkwmapealfdriythqsdvw
    sfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqr
    ptfkqlvedldrivalts