PDB entry 6myh

View 6myh on RCSB PDB site
Description: Mouse Gamma S Crystallin L16 Octamer
Class: protein binding
Keywords: Octamer Domain-swap Oxidation Disorder, PROTEIN BINDING
Deposited on 2018-11-01, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-crystallin S
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35486 (Start-177)
      • conflict (16)
    Domains in SCOPe 2.07: d6myha1, d6myha2
  • Chain 'B':
    Compound: Gamma-crystallin S
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35486 (Start-177)
      • conflict (16)
    Domains in SCOPe 2.07: d6myhb1, d6myhb2
  • Chain 'C':
    Compound: Gamma-crystallin S
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35486 (Start-177)
      • conflict (16)
    Domains in SCOPe 2.07: d6myhc1, d6myhc2
  • Chain 'D':
    Compound: Gamma-crystallin S
    Species: Mus musculus [TaxId:10090]
    Gene: Crygs
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35486 (Start-177)
      • conflict (16)
    Domains in SCOPe 2.07: d6myhd1, d6myhd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6myhA (A:)
    msktggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmy
    ilpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsime
    qfhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myhA (A:)
    tggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyilp
    qgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsimeqfh
    lreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6myhB (B:)
    msktggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmy
    ilpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsime
    qfhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myhB (B:)
    sktggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyi
    lpqgeypeyqrwmglndrlgscravhlssgqakiqvfekgdfngqmyettedcpsimeqf
    hlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6myhC (C:)
    msktggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmy
    ilpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsime
    qfhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myhC (C:)
    tggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyilp
    qgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsimeqfh
    lreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6myhD (D:)
    msktggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmy
    ilpqgeypeyqrwmglndrlgscravhlssggqakiqvfekgdfngqmyettedcpsime
    qfhlreihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myhD (D:)
    tggkisfyedrnflgrrydcdcdcadfrsylsrcnsirveggtwavyerpnfsghmyilp
    qgeypeyqrwmglndrlgscravhlsgqakiqvfekgdfngqmyettedcpsimeqfhlr
    eihsckvvegtwifyelpnyrgrqylldkkeyrkpvdwgaaspaiqsfrrive