PDB entry 6mya

View 6mya on RCSB PDB site
Description: Crystal structure of InvbP.18715.a.KN11: Influenza hemagglutinin from strain A/Almaty/32/1998
Class: viral protein
Keywords: Inflenza hemagglutinin, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2018-11-01, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myaa1, d6myaa2, d6myaa3
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myab1, d6myab2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myac1, d6myac2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myad1, d6myad2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myae1, d6myae2, d6myae3
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 6MYA
    Domains in SCOPe 2.07: d6myaf1, d6myaf2
  • Heterogens: NAG, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6myaA (A:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaA (A:)
    sdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpk
    esswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgv
    hhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdt
    iifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvt
    igecpkyvrstklrmvtglrnipsglfgaiagfieggwtgmidgwygyhhqneqgyaadq
    kstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtynael
    lvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmesvrngtyd
    ypkyseef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6myaB (B:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaB (B:)
    dticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpke
    sswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgvh
    hpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdti
    ifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvti
    gecpkyvrstklrmvtglrnipsglfgaiagfieggwtgmidgwygyhhqneqyaadqks
    tqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtynaellv
    llenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
    ky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6myaC (C:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaC (C:)
    sdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpk
    esswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgv
    hhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdt
    iifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvt
    igecpkyvrstklrmvtglrnipsglfgaiagfieggwtgmidgwygyhhqneqgsgyaa
    dqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtyna
    ellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmesvrngt
    ydypky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6myaD (D:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaD (D:)
    dticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpke
    sswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgvh
    hpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdti
    ifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvti
    gecpkyvrstklrmvtglrnipglfgaiagfieggwtgmidgwygyhhqneqgsgyaadq
    kstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtynael
    lvllenertldfhdsnvknlyekvksqlknngcfefyhkcdnecmesvrngtydypky
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6myaE (E:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaE (E:)
    sdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpk
    esswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgv
    hhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdt
    iifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvt
    igecpkyvrstklrmvtglrnipglfgaiagfieggwtgmidgwygyhhqneqgsgyaad
    qkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtynae
    llvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmesvrngty
    dypkyseef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6myaF (F:)
    gsdticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifp
    kesswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwg
    vhhpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgd
    tiifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpv
    tigecpkyvrstklrmvtglrnipsiqsrglfgaiagfieggwtgmidgwygyhhqneqg
    sgyaadqkstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldi
    wtynaellvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmes
    vrngtydypkyseeflvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6myaF (F:)
    dticigyhannstdtvdtlleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdsllparswsyivetpnsengacypgdfidyeelkeqlssvsslerfeifpke
    sswpnhntlkgvtascshggkssfyrnllwltktgdsypkltnsyvnnkgkevlvlwgvh
    hpsssneqqslyhnvnayvsvvssnynrrftpeiaarpkvrdqpgrmnyywtllepgdti
    ifeatgnliapwyafalsrgfgssiiisnasmhecntkcqtpqgainsslpfqnihpvti
    gecpkyvrstklrmvtglrnipglfgaiagfieggwtgmidgwygyhhqneqgsgyaadq
    kstqnaingitnkvnsviekmntqfttvgkefnnlekrmenlnkkvddgfldiwtynael
    lvllenertldfhdsnvknlyekvksqlknnakeigngcfefyhkcdnecmesvrngtyd
    ypky