PDB entry 6mx0

View 6mx0 on RCSB PDB site
Description: Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
Class: immune system
Keywords: innate immunity, signaling, open conformation, immune system
Deposited on 2018-10-30, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6 (1-End)
      • expression tag (0)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d6mx0a1, d6mx0a2
  • Chain 'B':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6 (1-End)
      • expression tag (0)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d6mx0b1, d6mx0b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mx0A (A:)
    svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
    madpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsq
    ysqagfsredrleqaklfcqtlediladapesqnncrliayqepaddssfslsqevlrhl
    rqeekeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mx0A (A:)
    svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
    madpnirfldklpqysnsiyellengqragtcvleyatplqtlfamsqysqagfsredrl
    eqaklfcqtlediladapesqnncrliayqepssfslsqevlrhlrqee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mx0B (B:)
    svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
    madpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsq
    ysqagfsredrleqaklfcqtlediladapesqnncrliayqepaddssfslsqevlrhl
    rqeekeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mx0B (B:)
    svahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
    madpnirfldklpqysnsiyellengqragtcvleyatplqtlfamsqysqagfsredrl
    eqaklfcqtlediladapesqnncrliayqepaddssfslsqevlrhlrqe