PDB entry 6mwa

View 6mwa on RCSB PDB site
Description: NavAb Voltage-gated Sodium Channel, residues 1-239
Class: membrane protein, metal transport
Keywords: Ion Channel Voltage-gated Sodium Channel, MEMBRANE PROTEIN, metal transport
Deposited on 2018-10-29, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-256)
      • expression tag (16-17)
    Domains in SCOPe 2.07: d6mwab1, d6mwab2
  • Heterogens: PX4, SO4, CPS, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mwaB (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaiivdama
    ilnqkeeqhiidevqsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mwaB (B:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptseilrvlrvlrlfrlvtavpqmrkivs
    alisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsm
    givrplmevypyawvffipfifvvtfvminlvvaiivdamailnqkeeqhiidevqsh