PDB entry 6mvy

View 6mvy on RCSB PDB site
Description: NavAb voltage-gated sodium channel, residues 1-226, crystallized in the presence of Class 1B Anti-arrhythmic drug Lidocaine
Class: membrane protein
Keywords: Ion channel Voltage-gated Sodium Channel, MEMBRANE PROTEIN
Deposited on 2018-10-28, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • expression tag (16-17)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvya1, d6mvya2
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • expression tag (16-17)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvyb1, d6mvyb2
  • Heterogens: PX4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mvyA (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaicvdama
    ilnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvyA (A:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptseilrvlrvlrlfrlvtavpqmrkivs
    alisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsm
    givrplmevypyawvffipfifvvtfvminlvvaicvdamail
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mvyB (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaicvdama
    ilnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvyB (B:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptseilrvlrvlrlfrlvtavpqmrkivs
    alisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsm
    givrplmevypyawvffipfifvvtfvminlvvaicvdamail