PDB entry 6mvv

View 6mvv on RCSB PDB site
Description: NavAb voltage-gated sodium channel, I217C/F203A
Class: membrane protein
Keywords: Ion channel Voltage-gated Sodium Channel, MEMBRANE PROTEIN
Deposited on 2018-10-28, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5
      • engineered mutation (220)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvva_
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5
      • engineered mutation (220)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvvb_
  • Chain 'C':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5
      • engineered mutation (220)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvvc_
  • Chain 'D':
    Compound: Ion transport protein
    Species: Arcobacter butzleri (strain RM4018) [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • engineered mutation (220)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d6mvvd_
  • Heterogens: PX4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mvvA (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfiavvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvvA (A:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
    mgivrplmevypyawvffipfiavvtfvminlvvaicvdama
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mvvB (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfiavvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvvB (B:)
    ylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftieii
    lriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkivs
    alisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsm
    givrplmevypyawvffipfiavvtfvminlvvaicvdamailnqkee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mvvC (C:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfiavvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvvC (C:)
    ylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftieii
    lriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkivs
    alisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtleswsm
    givrplmevypyawvffipfiavvtfvminlvvaicv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mvvD (D:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfiavvtfvminlvvaicvdama
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mvvD (D:)
    mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
    ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
    salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
    mgivrplmevypyawvffipfiavvtfvminlvvaicvdama