PDB entry 6mr6

View 6mr6 on RCSB PDB site
Description: E. coli cysteine desulfurase SufS H55A with a cysteine persulfide intermediate
Class: transferase
Keywords: cysteine desulfurase, SufS, persulfide, TRANSFERASE
Deposited on 2018-10-11, released 2019-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufS, csdB, ynhB, b1680, JW1670
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77444 (Start-419)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6mr6a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mr6A (A:)
    masmtggqqmgrgsmifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaef
    yrhgyaavargihtlsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswg
    nsnvragdniiisqmehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektr
    llaithvsnvlgtenplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghk
    lygptgigilyvkeallqemppwegggsmiatvslsegttwtkapwrfeagtpntggiig
    lgaaleyvsalglnniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhayd
    vgsfldnygiavrtghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mr6A (A:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavargihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg