PDB entry 6mnf

View 6mnf on RCSB PDB site
Description: Anti-HIV-1 Fab 2G12 + Man8 re-refinement
Class: immune system
Keywords: HIV-1 carbohydrate broadly neutralizing antibody, hiv neutralizing antibody, anti-carbohydrate, domain-swapping, IMMUNE SYSTEM
Deposited on 2018-10-01, released 2018-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MNF (0-223)
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MNF (0-212)
    Domains in SCOPe 2.08: d6mnfk1, d6mnfk2
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MNF (0-212)
    Domains in SCOPe 2.08: d6mnfl1, d6mnfl2
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MNF (0-223)
  • Heterogens: BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6mnfK (K:)
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6mnfL (L:)
dvvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvps
rfsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'M':
    No sequence available.