PDB entry 6mn8

View 6mn8 on RCSB PDB site
Description: Crystal Structure of Prolyl-tRNA Synthetase from Onchocerca volvulus with bound Halofuginone and nucleotide
Class: ligase
Keywords: SSGCID, ProRS, ATP-binding, aminoacylation, halofuginone, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2018-10-01, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Onchocerca volvulus [TaxId:6282]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mn8a1, d6mn8a2, d6mn8a3
  • Heterogens: HFG, ANP, AMP, 2PN, MG, GLY, SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mn8A (A:)
    mahhhhhhieiskdenysewyvqvitkaemieyydisgcyvlrpwsyaiwefiqewfdee
    ikklgvkncyfplfvsqsalekekthisdfapevawitragqsdlaeaiairptsetvmy
    psyakwvqshrdlpiklnqwcnvvrwefkhptpflrtreflwqeghtafqskdeaedevf
    kildlyaqiyidllaipvikgrktekenfaggdftatveayvpvngrgiqgatshhlgqn
    fskmfnisfedpngggkiyawqnswgistrtigalvmihgdncglvlpprvatiqmiivp
    vginaqtkdeqktaliekakeinnklmdasiraeldirdhispgwkfnhwelkgvpvrie
    igpkdlannqvtcvirysgekrtipidglaskckdmleeihysmynrilevreshtkivl
    ewndfrsfldqkfillspfcgriecedeikkesmrgeendpqapamgaktlcipleqpei
    plptncinkncpekpqffalfgrsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mn8A (A:)
    ahhhhhhieiskdenysewyvqvitkaemieyydisgcyvlrpwsyaiwefiqewfdeei
    kklgvkncyfplfvsqsalekefapevawitragqsdlaeaiairptsetvmypsyakwv
    qshrdlpiklnqwcnvvrwefkhptpflrtreflwqeghtafqskdeaedevfkildlya
    qiyidllaipvikgrkggdftatveayvpvngrgiqgatshhlgqnfskmfnisfedpng
    ggkiyawqnswgistrtigalvmihgdncglvlpprvatiqmiivpvgitkdeqktalie
    kakeinnklmdasiraeldirdhispgwkfnhwelkgvpvrieigpkdlannqvtcviry
    sgekrtipidglaskckdmleeihysmynrilevresht