PDB entry 6ml8

View 6ml8 on RCSB PDB site
Description: Crystal structure of hemagglutinin from H1N1 Influenza A virus A/Denver/57 bound to the C05 antibody
Class: viral protein
Keywords: NIAID, structural genomics, influenza virus, vaccine development, broadly neutralizing antibody, strain-specific neutralization, influenzavirus, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2018-09-27, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:385583]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ml8a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Denver/1957(H1N1)) [TaxId:385583]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ml8b_
  • Chain 'H':
    Compound: C05 antibody Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ML8 (0-End)
  • Chain 'L':
    Compound: C05 antibody Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ML8 (0-End)
    Domains in SCOPe 2.07: d6ml8l1, d6ml8l2
  • Heterogens: NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ml8A (A:)
    fagsdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgncn
    iagwvlgnpecesllsnrswsyiaetpnsengtcypgdfadyeelreqlssvssferfei
    fpkerswpnhttrgvtaacpharkssfyknlvwlteangsypnlsrsyvnnqekevlvlw
    gvhhpsnieeqralyrkdnayvsvvssnynrrftpeiakrpkvrdqsgrmnyywtllepg
    dtiifeatgnliapwyafalsrgpgsgiitsnapldecdtkcqtpqgainsslpfqnihp
    vtigecpkyvrstklrmvtglrnipsvqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml8A (A:)
    ticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgkaplqlgncniagwv
    lgnpecesllsnrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpker
    swpnhttrgvtaacpharkssfyknlvwlteangsypnlsrsyvnnqekevlvlwgvhhp
    snieeqralyrkdnayvsvvssnynrrftpeiakrpkvrdqsgrmnyywtllepgdtiif
    eatgnliapwyafalsrgpgsgiitsnapldecdtkcqtpqgainsslpfqnihpvtige
    cpkyvrstklrmvtglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ml8B (B:)
    glfgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklekrmenlnkkvddgfmdiwtynaellvllenertldfhdsnvknlye
    kvknqlrnnakelgngcfefyhkcdnecmesvkngtydypkysee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml8B (B:)
    fgaiagfieggwtgmmdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntq
    ftavgkefnklekrmenlnkkvddgfmdiwtynaellvllenertldfhdsnvknlyekv
    knqlrnnakelgngcfefyhkcdnecmesvkngtydy
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ml8L (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ml8L (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg