PDB entry 6mjn

View 6mjn on RCSB PDB site
Description: Crystal structure of an organic hydroperoxide resistance protein OsmC, predicted redox protein, regulator of sulfide bond formation from Legionella pneumophila
Class: oxidoreductase
Keywords: NIAID, structural genomics, disulfide, active site cysteine, redox, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2018-09-21, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein
    Species: Legionella pneumophila [TaxId:446]
    Gene: C3927_09130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mjna_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein
    Species: Legionella pneumophila [TaxId:446]
    Gene: C3927_09130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mjnb1, d6mjnb2
  • Chain 'C':
    Compound: organic hydroperoxide resistance protein
    Species: Legionella pneumophila [TaxId:446]
    Gene: C3927_09130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mjnc_
  • Chain 'D':
    Compound: organic hydroperoxide resistance protein
    Species: Legionella pneumophila [TaxId:446]
    Gene: C3927_09130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mjnd1, d6mjnd2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mjnA (A:)
    mahhhhhhmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaag
    yaacfesairhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaeal
    vakahevcpysnairgnvdvklsvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mjnA (A:)
    kalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesai
    rhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevcp
    ysnairgnvdvklsvsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mjnB (B:)
    mahhhhhhmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaag
    yaacfesairhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaeal
    vakahevcpysnairgnvdvklsvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mjnB (B:)
    hmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfes
    airhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahev
    cpysnairgnvdvklsvsvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mjnC (C:)
    mahhhhhhmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaag
    yaacfesairhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaeal
    vakahevcpysnairgnvdvklsvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mjnC (C:)
    kalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesai
    rhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevcp
    ysnairgnvdvklsvsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mjnD (D:)
    mahhhhhhmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaag
    yaacfesairhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaeal
    vakahevcpysnairgnvdvklsvsvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mjnD (D:)
    hmkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfes
    airhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahev
    cpysnairgnvdvklsvsv