PDB entry 6mi6

View 6mi6 on RCSB PDB site
Description: structure of chea domain p4 in complex with an ADP analog
Class: signaling protein
Keywords: bacterial chemotaxis, histidine kinase, Thermotoga maritima, SIGNALING PROTEIN
Deposited on 2018-09-19, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: cheA, TM_0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mi6a_
  • Chain 'B':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: cheA, TM_0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mi6b_
  • Chain 'C':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: cheA, TM_0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mi6c_
  • Chain 'D':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: cheA, TM_0702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mi6d_
  • Heterogens: SO4, JSJ, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mi6A (A:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
    vtirlpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mi6A (A:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfsvsevsgrgvgmdvvknvveslngsisiesekdkgtkvtir
    lpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mi6B (B:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
    vtirlpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mi6C (C:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
    vtirlpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mi6C (C:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnvvieveddgrgidkekiirkaiekglidesk
    aatlsdqeilnflfvpgfstkvsevsgrgvgmdvvknvveslngsisiesekdkgtkvti
    rlpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mi6D (D:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
    vtirlpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mi6D (D:)
    irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvsgrgvgmdvvknvveslngsisiesekdkgtkvtirlpl