PDB entry 6mhr

View 6mhr on RCSB PDB site
Description: Structure of the human 4-1BB / Urelumab Fab complex
Class: immune system
Keywords: Signaling, TNFRSF, 4-1BB, CD137, IMMUNE SYSTEM, therapeutic antibody, complex
Deposited on 2018-09-18, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urelumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MHR (0-End)
  • Chain 'B':
    Compound: Urelumab Fab kappa chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MHR (0-End)
    Domains in SCOPe 2.07: d6mhrb1, d6mhrb2
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07011 (0-137)
      • expression tag (138-140)
  • Chain 'D':
    Compound: Urelumab Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MHR (0-End)
  • Chain 'E':
    Compound: Urelumab Fab kappa chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6MHR (0-End)
    Domains in SCOPe 2.07: d6mhre1, d6mhre2
  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF9, CD137, ILA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07011 (0-137)
      • expression tag (138-139)
  • Heterogens: GOL, MLI, NAG, BMA, FUC, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mhrB (B:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppaltfgggtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mhrB (B:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppaltfgggtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6mhrE (E:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppaltfgggtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mhrE (E:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwppaltfgggtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    No sequence available.