PDB entry 6mh3

View 6mh3 on RCSB PDB site
Description: The crystal structure of Zika virus NS3 helicase domain
Class: RNA binding protein
Keywords: NS3 HELICASE DOMAIN RNA dependent NTP dependent, RNA BINDING PROTEIN
Deposited on 2018-09-17, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zika virus NS3 helicase domain
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mh3a1, d6mh3a2
  • Heterogens: EDO, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mh3A (A:)
    mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
    ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis
    trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf
    vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr
    vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetde
    ghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdlp
    vwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcsd
    haalksfkefaagkr