PDB entry 6mgx

View 6mgx on RCSB PDB site
Description: Crystal Structure of the New Deli Metallo Beta Lactamase Variant 6 Klebsiella pneumoniae
Class: hydrolase
Keywords: metallo beta lactamase, carbapenemases, Structural Genomics, Center for Structural Genomics of Infectious Diseases, HYDROLASE
Deposited on 2018-09-16, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mgxa_
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mgxb_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mgxA (A:)
    snairptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
    vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
    lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
    clikdskakslgnlgdadtehyaasvrafgaafpkasmivmshsapdsraaithtarmad
    klr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mgxA (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmfgavasnglivrdggrvlvvdtawtddqtaqiln
    wikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltf
    aangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgd
    adtehyaasvrafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mgxB (B:)
    snairptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
    vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
    lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
    clikdskakslgnlgdadtehyaasvrafgaafpkasmivmshsapdsraaithtarmad
    klr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mgxB (B:)
    tgdqrfgdlvfrqlapnvwqhtsyldmgavasnglivrdggrvlvvdtawtddqtaqiln
    wikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltf
    aangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgd
    adtehyaasvrafgaafpkasmivmshsapdsraaithtarmadklr