PDB entry 6mgg

View 6mgg on RCSB PDB site
Description: Succinyl-CoA synthase from Francisella tularensis, phosphorylated, in complex with CoA
Class: ligase
Keywords: Succinyl-CoA synthase, structural genomics, CPX_02187_02692, IDP02187, IDP02692, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-09-13, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate--CoA ligase [ADP-forming] subunit alpha
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: sucD, BZ14_337
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0G2RQ73 (Start-289)
      • engineered mutation (84)
      • expression tag (290-293)
    Domains in SCOPe 2.07: d6mgga1, d6mgga2, d6mgga3
  • Chain 'B':
    Compound: Succinate--CoA ligase [ADP-forming] subunit beta
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: sucC, FTT_0504c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NHF3 (0-386)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6mggb1, d6mggb2
  • Chain 'C':
    Compound: Succinate--CoA ligase [ADP-forming] subunit alpha
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: sucD, BZ14_337
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0G2RQ73 (Start-289)
      • engineered mutation (84)
      • expression tag (290-295)
    Domains in SCOPe 2.07: d6mggc1, d6mggc2, d6mggc3
  • Chain 'D':
    Compound: Succinate--CoA ligase [ADP-forming] subunit beta
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: sucC, FTT_0504c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NHF3 (0-386)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d6mggd1, d6mggd2
  • Heterogens: COA, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mggA (A:)
    msvlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaea
    vaatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvi
    gpncpgiitpgeckigimpghihmkgkvgiisrsgtltyeavaqttklgfgqstcigigg
    dpipgmnqiealkllendpqteaiiligeiggtaeeeaaeyikhnvtkpvigyiagvtap
    pgkrmghagaiisggkgtaeekfaafeaagiaytrspaeigkklkevtgwenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mggA (A:)
    svlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaeav
    aatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvig
    pncpgiitpgeckigimpghihmkgkvgiisrsgtltyeavaqttklgfgqstcigiggd
    pipgmnqiealkllendpqteaiiligeiggtaeeeaaeyikhnvtkpvigyiagvtapp
    gkrmghagaiisggkgtaeekfaafeaagiaytrspaeigkklkevtgwenly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mggB (B:)
    mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv
    kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr
    kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk
    tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqen
    akelkasehelnyvalegnigcmvngaglamatmdiiqlyggkpanfldvgggatkervi
    eafklilddenvkailinifggivrcdmiaeaiieavkevnvtvpvvvrlegnnaekgak
    iladsglklipadgladaadkvvkslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mggC (C:)
    msvlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaea
    vaatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvi
    gpncpgiitpgeckigimpghihmkgkvgiisrsgtltyeavaqttklgfgqstcigigg
    dpipgmnqiealkllendpqteaiiligeiggtaeeeaaeyikhnvtkpvigyiagvtap
    pgkrmghagaiisggkgtaeekfaafeaagiaytrspaeigkklkevtgwenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mggC (C:)
    svlvdkntkvlvqgftgkngtfhseqaiaygtnivggvtpgkggtthldrpvfntmaeav
    aatgadasviyvpapfvkdsaievidsgvklvviitegvptldmlvvkeylkdkdvrvig
    pncpgiitpgeckigimpghihmkgkvgiisrsgtltyeavaqttklgfgqstcigiggd
    pipgmnqiealkllendpqteaiiligeiggtaeeeaaeyikhnvtkpvigyiagvtapp
    gkrmghagaiisggkgtaeekfaafeaagiaytrspaeigkklkevtgwenlyfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6mggD (D:)
    mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv
    kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr
    kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk
    tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqen
    akelkasehelnyvalegnigcmvngaglamatmdiiqlyggkpanfldvgggatkervi
    eafklilddenvkailinifggivrcdmiaeaiieavkevnvtvpvvvrlegnnaekgak
    iladsglklipadgladaadkvvkslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mggD (D:)
    mnlheyqakdllesyglkvqkgivahnpneaaqafdqlggkfavvkaqvhaggrgkaggv
    kvvkssqetrevaesligknlvtfqtdaegqpvnsvgvfedvypvtrelylgavvdrssr
    kvtfmasteggvdieevahnspekilkvevdplvglqpfqarevafklglegkqindfvk
    tmlgaykafiecdfalfeinplavrengeivcvdgkinldsnalyrhpkllalrdksqen
    akelkasehelnyvalegnigcmvngaglamatmdiiqlyggkpanfldvgggatkervi
    eafklilddenvkailinifgcdmiaeaiieavkevnvtvpvvvrlegglklipadglad
    aadkvvkslg