PDB entry 6mfm

View 6mfm on RCSB PDB site
Description: Structure of thiamine-monophosphate kinase from Acinetobacter baumannii in complex with adenosine diphosphate (ADP) and thiamine diphosphate (TPP), orthorhombic crystal form
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2018-09-11, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092, CBI29_03781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mfma1, d6mfma2
  • Chain 'B':
    Compound: Thiamine-monophosphate kinase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: thiL, ABUW_0092, CBI29_03781
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mfmb1, d6mfmb2
  • Heterogens: ADP, TPP, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mfmA (A:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mfmA (A:)
    aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig
    wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq
    gphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptp
    rcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwq
    yalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgy
    qhfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mfmB (B:)
    mahhhhhhmaefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfp
    letsphaigwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgv
    aliggdttqgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghsl
    qqrldyptprcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlq
    qieeqqrwqyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgs
    dyplqihgyqhfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mfmB (B:)
    maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
    gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
    qgphltitvtamgwietgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldypt
    prcklgeelkglassmidvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrw
    qyalaggddyelcftitpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihg
    yqhf