PDB entry 6mfl

View 6mfl on RCSB PDB site
Description: Structure of siderophore binding protein BauB bound to a complex between two molecules of acinetobactin and ferric iron.
Class: metal transport
Keywords: Siderophore Binding Protein, periplasmic protein, substrate binding protein, iron acquisition, METAL TRANSPORT
Deposited on 2018-09-11, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BauB
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bauB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76HK0 (Start-299)
      • expression tag (300-302)
    Domains in SCOPe 2.07: d6mfla1, d6mfla2
  • Chain 'B':
    Compound: BauB
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bauB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76HK0 (Start-299)
      • expression tag (300-302)
    Domains in SCOPe 2.07: d6mflb1, d6mflb2
  • Heterogens: OPV, FE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mflA (A:)
    cdqkvadttqasqklaepitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpk
    dyvphflekykkdaqiqdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihy
    dinfnnsesnhiglvkdhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvv
    lhnngafsnfgiqsrygfifnafgvkpasgvvdtslhgqpissefikkadpdilyivdrt
    avmehrpninaasvenpllrqtkawkngrvifvdadawyttaasptslkivmedvkkgyq
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mflA (A:)
    epitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpkdyvphflekykkdaqi
    qdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihydinfnnsesnhiglvk
    dhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvvlhnngafsnfgiqsry
    gfifnafgvkpasgvvdhgqpissefikkadpdilyivdrtavmehrpninaasvenpll
    rqtkawkngrvifvdadawyttaasptslkivmedvkkgyqleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6mflB (B:)
    cdqkvadttqasqklaepitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpk
    dyvphflekykkdaqiqdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihy
    dinfnnsesnhiglvkdhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvv
    lhnngafsnfgiqsrygfifnafgvkpasgvvdtslhgqpissefikkadpdilyivdrt
    avmehrpninaasvenpllrqtkawkngrvifvdadawyttaasptslkivmedvkkgyq
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mflB (B:)
    epitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpkdyvphflekykkdaqi
    qdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihydinfnnsesnhiglvk
    dhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvvlhnngafsnfgiqsry
    gfifnafgvkpasgvvdqpissefikkadpdilyivdrtavmehrpninaasvenpllrq
    tkawkngrvifvdadawyttaasptslkivmedvkkgyqleh