PDB entry 6mfk

View 6mfk on RCSB PDB site
Description: Crystal Structure of Chloramphenicol Acetyltransferase from Elizabethkingia anophelis
Class: transferase
Keywords: SSGCID, transferase, antibiotic resistance, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-09-11, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloramphenicol acetyltransferase
    Species: Elizabethkingia anophelis [TaxId:1117645]
    Gene: catB, BAY10_06425, E18064_290343
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5KVH4 (8-215)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6mfka1, d6mfka2
  • Heterogens: MPD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mfkA (A:)
    mahhhhhhmknffespfkgkiikdhiqnpniiagkysyysgyyhghsfddcaryllpdrn
    dvdkliigsycsvgtgasfimagnqghrydwissfpffymneveafensidafknagdti
    igndvwiggeamimpgikigdgavigsralvtkdvepyaivggnpaklikkrfsenqiai
    lleikwwewneevladampilcsgnidllykfykni
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mfkA (A:)
    hhmknffespfkgkiikdhiqnpniiagkysyysgyyhghsfddcaryllpdrndvdkli
    igsycsvgtgasfimagnqghrydwissfpffymneveafensidafknagdtiigndvw
    iggeamimpgikigdgavigsralvtkdvepyaivggnpaklikkrfsenqiailleikw
    wewneevladampilcsgnidllykfykni