PDB entry 6mfg

View 6mfg on RCSB PDB site
Description: HLA-DQ2-glia-alpha1
Class: immune system
Keywords: Immune complex, Gliadin epitope, Celiac Disease, TCR cross reactivity, IMMUNE SYSTEM
Deposited on 2018-09-10, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mfga1, d6mfga2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6mfgc1, d6mfgc2
  • Chain 'E':
    Compound: MHC class II HLA-DQ-beta-1 - DQ2-glia-alpha1 chimeric protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • PDB 6MFG (0-10)
    • Uniprot O19712
  • Chain 'F':
    Compound: MHC class II HLA-DQ-beta-1 - DQ2-glia-alpha1 chimeric protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • PDB 6MFG (0-10)
    • Uniprot O19712
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mfgA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epesgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mfgA (A:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6mfgC (C:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epesgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mfgC (C:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    e
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.