PDB entry 6mel

View 6mel on RCSB PDB site
Description: Succinyl-CoA synthase from Campylobacter jejuni
Class: ligase
Keywords: Succinyl-CoA synthase, structural genomics, CPX_90676_90715, IDP90715, IDP90676, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-09-06, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate--CoA ligase subunit alpha
    Species: Campylobacter jejuni [TaxId:197]
    Gene: DDV82_04720, DDV86_02895
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2U0Q9D2 (Start-288)
      • expression tag (289)
    Domains in SCOPe 2.07: d6mela1, d6mela2, d6mela3
  • Chain 'B':
    Compound: Succinate--CoA ligase [ADP-forming] subunit beta
    Species: Campylobacter jejuni (strain RM1221) [TaxId:195099]
    Gene: sucC, CJE0637
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6melb1, d6melb2
  • Heterogens: CL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6melA (A:)
    msilvnkntkvivqgftgkeatfhaeqcmaygtnivggitphkggqthlgkpvfdtvada
    vkatkadvslifvpafavgdsvieaadagiklavvitehtpvkdmmfakqyankkgmkii
    gpncpgiitseecklgimpgfifkkgcvglisksgtltyeaanqvvqggygistavgigg
    dpiiglaykellsefqkddetkaivmigeiggsleveaakfikeniskpvvafiagatap
    kgkrmghagaivgsadesaaakkealksygihvvdspaligeeiqkilgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6melA (A:)
    silvnkntkvivqgftgkeatfhaeqcmaygtnivggitphkggqthlgkpvfdtvadav
    katkadvslifvpafavgdsvieaadagiklavvitehtpvkdmmfakqyankkgmkiig
    pncpgiitseecklgimpgfifkkgcvglisksgtltyeaanqvvqggygistavgiggd
    piiglaykellsefqkddetkaivmigeiggsleveaakfikeniskpvvafiagatapk
    gkrmghagaivgsadesaaakkealksygihvvdspaligeeiqkilge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6melB (B:)
    mniheyqakaifvdngiptlkgkvafsvdeavanakelggsvwavkaqihaggrglgggv
    kiaknldevkdyaskilgmnlvthqtgpegklvqklyiesganivkeyylailfnrmaeq
    itiiasseggmdiekvakespekiakvgidpqigfkmfhglevarvlgldkdegkklism
    iaklyklymdkdmnmleinpliktaegdfyaldakcsfddsalyrhpeiaelrdtteenp
    aereaaefglsyvkldgdvacmvngaglamatmdiinysgakpanfldvgggaspetvak
    afeiilrdknvkvifinifggivrcdriangileatknvevnipivvrldgtnaaeakti
    ldnsnlknikaatnlkngaelvkslvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6melB (B:)
    mniheyqakaifvdngiptlkgkvafsvdeavanakelggsvwavkaqihaggrglgggv
    kiaknldevkdyaskilgmnlvthqtgpegklvqklyiesganivkeyylailfnrmaeq
    itiiasseggmdiekvakespekiakvgidpqigfkmfhglevarvlgldkdegkklism
    iaklyklymdkdmnmleinpliktaegdfyaldakcsfddsalyrhpeiaelrdtteenp
    aereaaefglsyvkldgdvacmvngaglamatmdiinysgakpanfldvgggaspetvak
    afeiilrdknvkvifinifggivrcdriangileatknvevnipivvrldgtnaaeakti
    ldnsnlknikaatnlkngaelvkslv