PDB entry 6mdq

View 6mdq on RCSB PDB site
Description: Crystal structure of equine serum albumin in complex with testosterone
Class: transport protein
Keywords: Albumin, Equine Serum Albumin, Testosterone, CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, TRANSPORT PROTEIN
Deposited on 2018-09-05, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (Start-582)
      • see remark 999 (559)
    Domains in SCOPe 2.07: d6mdqa1, d6mdqa2, d6mdqa3
  • Heterogens: TES, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mdqA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mdqA (A:)
    kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
    kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
    aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
    lkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhke
    cchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpa
    laadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaea
    dppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlv
    eigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaer
    rpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeql
    ktvlgnfsafvakccgaedkeacfaeegpklvassqlala