PDB entry 6mdh

View 6mdh on RCSB PDB site
Description: X-ray crystal structure of ISG15 from Myotis davidii
Class: signaling protein
Keywords: interferon, innate immune response, ubiquitin-like, SIGNALING PROTEIN
Deposited on 2018-09-04, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein ISG15
    Species: Myotis davidii [TaxId:225400]
    Gene: MDA_GLEAN10007532
    Database cross-references and differences (RAF-indexed):
    • Uniprot L5LC70 (8-End)
      • expression tag (1-7)
    Domains in SCOPe 2.07: d6mdha1, d6mdha2, d6mdha3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6mdhA (A:)
    mggylkvkmlsnefqvpmrdsmllselkqlitqkiqvpafrqrllvqgsnevlqdgvpla
    hqglrsgsevvlvvqscdrplsilvrndrgnnrayevqltqkvarlkeqvaerestnvdq
    fwlsfqgqplddekqlgeydltphctvqmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6mdhA (A:)
    ggylkvkmnefqvpmrdsmllselkqlitqkiqvpafrqrllvqgsnevlqdgvplahqg
    lrsgsevvlvvqscdrplsilvrndrgnnrayevqltqkvarlkeqvaerestnvdqfwl
    sfqgqplddekqlgeydltphctvqmnlr