PDB entry 6md8

View 6md8 on RCSB PDB site
Description: Crystal structure of CTX-M-14 with compound 3
Class: hydrolase/inhibitor
Keywords: Tetrazole, inhibitor, complex, Extended spectrum beta-lactamase, HYDROLASE, HYDROLASE-INHIBITOR complex
Deposited on 2018-09-04, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6md8a_
  • Chain 'B':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M-14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6md8b_
  • Heterogens: J84, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6md8A (A:)
    etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6md8B (B:)
    etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6md8B (B:)
    avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
    qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
    tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
    twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
    naesrrdvlasaariiaegl