PDB entry 6man

View 6man on RCSB PDB site
Description: Crystal structure of a DnaN sliding clamp DNA polymerase III subunit beta from Rickettsia bellii RML369-C
Class: transcription
Keywords: National Institute of Allergy and Infectious Disease, NIAID, structural genomoics, DnaN, sliding clamp, polymerase, griselimycin, antibiotic, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION
Deposited on 2018-08-28, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta sliding clamp
    Species: Rickettsia bellii (strain RML369-C) [TaxId:336407]
    Gene: dnaN, RBE_0656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RIS7 (8-386)
      • expression tag (7)
    Domains in SCOPe 2.07: d6mana1, d6mana2, d6mana3, d6mana4
  • Chain 'B':
    Compound: Beta sliding clamp
    Species: Rickettsia bellii (strain RML369-C) [TaxId:336407]
    Gene: dnaN, RBE_0656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1RIS7 (8-386)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d6manb1, d6manb2, d6manb3, d6manb4
  • Heterogens: EDO, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6manA (A:)
    mahhhhhhmlkvivetktlvqalgfassvvekrniiselanikllakdgllelsstnmdl
    ylsqkigvqvvsegeltvstktlndivkklpdseltltdlgttgleitgkncrfnlftlp
    vesfpvmdninpeasfkiscaefakiiestkfsvsldetrynlngiylhvkdsefyaast
    dghrlsvssvvlaekiedfgvilpqksaeeilkivkdsknanadieillssnkikficne
    nvimlsklidgtfpdyssfipensssklvinrkifadtieriaiitvekfravklslsge
    aleisaigeargnakevinssketenfyeysgetnldigfnpqyledvlkaiksdlvely
    fssvsapvlikfpespkdifvvmpvkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6manA (A:)
    hmlkvivetktlvqalgfassvvekrniiselanikllakdgllelsstnmdlylsqkig
    vqvvsegeltvstktlndivkklpdseltltdlgttgleitgkncrfnlftlpvesfpvm
    dninpeasfkiscaefakiiestkfsvsldetrynlngiylhvkdsefyaastdghrlsv
    ssvvlaekiedfgvilpqksaeeilkivkdsknanadieillssnkikficnenvimlsk
    lidgtfpdyssfipensssklvinrkifadtieriaiitvekfravklslsgealeisai
    geargnakevinssketenfyeysgetnldigfnpqyledvlkaiksdlvelyfssvsap
    vlikfpespkdifvvmpvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6manB (B:)
    mahhhhhhmlkvivetktlvqalgfassvvekrniiselanikllakdgllelsstnmdl
    ylsqkigvqvvsegeltvstktlndivkklpdseltltdlgttgleitgkncrfnlftlp
    vesfpvmdninpeasfkiscaefakiiestkfsvsldetrynlngiylhvkdsefyaast
    dghrlsvssvvlaekiedfgvilpqksaeeilkivkdsknanadieillssnkikficne
    nvimlsklidgtfpdyssfipensssklvinrkifadtieriaiitvekfravklslsge
    aleisaigeargnakevinssketenfyeysgetnldigfnpqyledvlkaiksdlvely
    fssvsapvlikfpespkdifvvmpvkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6manB (B:)
    hhhmlkvivetktlvqalgfassvveanikllakdgllelsstnmdlylsqkigvqvvse
    geltvstktlndivkklpdseltltdlgttgleitgkncrfnlftlpvesfpvmdninpe
    asfkiscaefakiiestkfsvsldetrynlngiylhvkdsefyaastdghrlsvssvvla
    ekiedfgvilpqksaeeilkivkdsknanadieillssnkikficnenvimlsklidgtf
    pdyssfipensssklvinrkifadtieriaiitvekfravklslsgealeisaigeargn
    akevinssketenfyeysgetnldigfnpqyledvlkaiksdlvelyfssvsapvlikfp
    espkdifvvmpvkv