PDB entry 6ma8

View 6ma8 on RCSB PDB site
Description: Human CYP3A4 bound to PMSF
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex, CYP3A4
Deposited on 2018-08-26, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ma8a_
  • Heterogens: HEM, GOL, PMF, EDO, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ma8A (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ma8A (A:)
    gthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlait
    dpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
    vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfve
    ntkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledrv
    dflqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqee
    idavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvv
    mipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmkl
    alirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd