PDB entry 6m9h

View 6m9h on RCSB PDB site
Description: JAK2 JH2 in complex with diaminopyrimidine JAK040
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE/TRANSFERASE INHIBITOR, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-08-23, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK2
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60674 (0-End)
      • engineered mutation (123)
      • engineered mutation (241)
      • engineered mutation (258)
    Domains in SCOPe 2.07: d6m9ha_
  • Heterogens: J9D, GOL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m9hA (A:)
    vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff
    eaasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevak
    qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer
    ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap
    kaaelanlinncmdyepdhrpsfraiirdlnslftpdlvprgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m9hA (A:)
    vfhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesff
    eaasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevak
    qlaaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqer
    ipwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpap
    kaaelanlinncmdyepdhrpsfraiirdlnsl