PDB entry 6m8z

View 6m8z on RCSB PDB site
Description: Crystal structure of human DJ-1 without a modification on Cys-106
Class: unknown function
Keywords: the exact function of this protein is still unknown, UNKNOWN FUNCTION
Deposited on 2018-08-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein/nucleic acid deglycase DJ-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m8za_
  • Heterogens: EPE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m8zA (A:)
    gamaskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasl
    edakkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheig
    fgskvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkeva
    aqvkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m8zA (A:)
    askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
    kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
    kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
    kaplvlk