PDB entry 6m8o

View 6m8o on RCSB PDB site
Description: Crystal structure of the receiver domain of LytR from Staphylococcus aureus
Class: signaling protein
Keywords: Two-Component System, Response Regulator, Receiver Domain, SIGNALING PROTEIN
Deposited on 2018-08-22, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: C3B39_09020, EP54_06415, EQ90_12235, HMPREF3211_02791
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m8oa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m8oA (A:)
    mkaliiddeplarneltyllneiggfeeineaenvketleallinqydiifldvnlmden
    gielgakiqkmkeppaiifatahdqyavqafelnatdyilkpfgqkrieqavnkvratka
    kddnnasaiandms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m8oA (A:)
    mkaliiddeplarneltyllneiggfeeineaenvketleallinqydiifldvnlmden
    gielgakiqkmkeppaiifatahdqyavqafelnatdyilkpfgqkrieqavnkvrat