PDB entry 6m7f

View 6m7f on RCSB PDB site
Description: Wild-type Cucumene Synthase
Class: lyase
Keywords: Triquinane Scaffold, Open Conformation, Terpene Cyclase, LYASE
Deposited on 2018-08-20, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cucumene Synthase
    Species: Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) [TaxId:443255]
    Gene: SSCG_00251
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m7fa_
  • Chain 'B':
    Compound: Cucumene Synthase
    Species: Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) [TaxId:443255]
    Gene: SSCG_00251
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cucumene Synthase
    Species: Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) [TaxId:443255]
    Gene: SSCG_00251
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6m7fc_
  • Chain 'D':
    Compound: Cucumene Synthase
    Species: Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) [TaxId:443255]
    Gene: SSCG_00251
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6m7fA (A:)
    mpqdvvfdlpwplrkhpgvagarehclgwlaaqgladrrgltaetfvtwqldelagyffp
    ratqeglelatdlmvwyfapfddqfdgalgrdprrtagvcaglaevlygvpepgpvassp
    vgralgdlwrrsctgmspfwrtrarhnwtgylaahtaesvpryhgrtvdaaycvrqrgya
    tsshvimdliertggfevpamvwhhpvlvelrtltsemigisndlcsaekeeadgdlsnn
    lllvlenhegldrpeaieraraltaervarfldveravtdvdclldgagreavrrfvegl
    hdlvrgdnewerttgryqpaisglqdladlmssgwdplasgtaaghgghtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m7fA (A:)
    fdlpwplrkhpgvagarehclgwlaaqglagltaetfvtwqldelagyffpratqeglel
    atdlmvwyfapfddqfdgalgrdprrtagvcaglaevlygvpepgpvasspvgralgdlw
    rrsctgmspfwrtrarhnwtgylaahtaesvprydaaycvrqrgyatsshvimdliertg
    gfevpamvwhhpvlvelrtltsemigisndlcsaesnnlllvlenhegldrpeaierara
    ltaervarfldveravtdvdclldgagreavrrfveglhdlvrgdnewertt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6m7fC (C:)
    mpqdvvfdlpwplrkhpgvagarehclgwlaaqgladrrgltaetfvtwqldelagyffp
    ratqeglelatdlmvwyfapfddqfdgalgrdprrtagvcaglaevlygvpepgpvassp
    vgralgdlwrrsctgmspfwrtrarhnwtgylaahtaesvpryhgrtvdaaycvrqrgya
    tsshvimdliertggfevpamvwhhpvlvelrtltsemigisndlcsaekeeadgdlsnn
    lllvlenhegldrpeaieraraltaervarfldveravtdvdclldgagreavrrfvegl
    hdlvrgdnewerttgryqpaisglqdladlmssgwdplasgtaaghgghtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6m7fC (C:)
    fdlpwplrkhpgvagarehclgwlaaqgladtfvtwqldelagyffpratqeglelatdl
    mvwyfapfddqfrtagvcaglaevlygvpepgpvasspvgralgdlwrrsctgmspfwrt
    rarhnwtgylaahtaesvvdaaycvrqrgyatsshvimdliertggfevpamvwhhpvlv
    elrtltsemigisndlcssnnlllvlenhegldrpeaieraraltaervarfldveravt
    dvdclldgagreavrrfveglhdlvrgdnewertt
    

  • Chain 'D':
    No sequence available.