PDB entry 6lt6

View 6lt6 on RCSB PDB site
Description: Crystal structure of rhesus macaque MHC class I molecule Mamu-B*05104 complexed with lysophosphatidylcholine
Class: immune system
Keywords: MHC class I protein, complex, lysophospholipid, IMMUNE SYSTEM
Deposited on 2020-01-21, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Macaca mulatta [TaxId:9544]
    Gene: Mamu-B, B
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZHY7 (0-275)
      • engineered mutation (127)
      • engineered mutation (176)
    Domains in SCOPe 2.08: d6lt6a1, d6lt6a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Macaca mulatta [TaxId:9544]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6lt6b_
  • Heterogens: EKG, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lt6A (A:)
    gshslryfgtavsrpgrgeprfiyvgyvddtqfvrfdsdaasprteprapwveqegpeyw
    eeetrrakaraqtdradlrtlrgyynqseagshtlqwmagcdlgpngrllrgyhqsaydg
    kdyialnedlrswiaadmaaqntqrkweatryaerfraylegpclewlrrylengketlq
    hadppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdiefvetrpagdgt
    fqkwgavvvpsgeeqrytchvqhkglpepltlrwep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lt6B (B:)
    aiqrtpkiqvysrhppengkpnflncyvsgfhpsdievdllkngekmgkvehsdlsfskd
    wsfyllyyteftpnekdeyacrvnhvtlsgprtvkwdrdm