PDB entry 6lsp

View 6lsp on RCSB PDB site
Description: Crystal structure of a dimeric Piptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.50 A resolution reveals an inhibited form.
Class: hydrolase
Keywords: Hydrolase
Deposited on 2020-01-18, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, BIT33_16330, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d6lspa_
• Chain 'B':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, BIT33_16330, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (0-192)
  Domains in SCOPe 2.07: d6lspb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6lspA (A:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6lspB (B:)
  msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
  rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
  ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
  pqamnqinaykpa