PDB entry 6lso

View 6lso on RCSB PDB site
Description: Crystal structure of a dimeric inhibited of peptidyl tRNA hydrolase at 1.76A resolution
Class: hydrolase
Keywords: Hydrolase
Deposited on 2020-01-17, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, BIT33_16330, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6lsoa_
  • Chain 'B':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, BIT33_16330, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6lsob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lsoA (A:)
    msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
    rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
    ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
    pqamnqinaykpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6lsoB (B:)
    msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
    rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
    ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
    pqamnqinaykpa