PDB entry 6ldh

View 6ldh on RCSB PDB site
Description:
Deposited on 1987-11-25, released 1989-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d6ldh_1, d6ldh_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ldh_ (-)
    atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
    emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
    ipnivkhspdciilvvsnpvdvltyvawklsglpmhriigsgcnldsarfrylmgerlgv
    hscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkdkqdwkklhkdvvdsayevik
    lkgytswaiglsvadlaetimknlcrvhpvstmvkdfygikdnvflslpcvlndhgisni
    vkmklkpneeqqlqksattlwdiqkdlkf