PDB entry 6l9k

View 6l9k on RCSB PDB site
Description: H2-Ld a1a2 complexed with A5 peptide
Class: immune system
Keywords: Major Histocompatibility Complex, IMMUNE SYSTEM
Deposited on 2019-11-10, released 2020-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H2-Ld a1a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6L9K (0-174)
    Domains in SCOPe 2.07: d6l9ka_
  • Chain 'Q':
    Compound: ser-pro-ser-tyr-ala-tyr-his-gln-phe
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6L9K (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6l9kA (A:)
gphsmryyetatsrrglgeprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqrmygcdvgsdgrllrgyeqfaydg
cdyialnedlrtwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkng

  • Chain 'Q':
    No sequence available.