PDB entry 6l6e

View 6l6e on RCSB PDB site
Description: Human PDE5 catalytic core in complex with avanafil
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase isoform 5, avanafil, enzyme-drug complex, co-crystallization, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2019-10-28, released 2020-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-02, with a file datestamp of 2020-08-28.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6l6ea_
  • Heterogens: E6L, ZN, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6l6eA (A:)
    metrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeqqelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6l6eA (A:)
    etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
    crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
    dhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlki
    ikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiq
    qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
    sedcfplldgcrknrqkwqalaeq