PDB entry 6k2o

View 6k2o on RCSB PDB site
Description: Structural basis of glycan recognition in globally predominant human P[8] rotavirus
Class: viral protein
Keywords: glycan binding specificity, VP8* structure, mucin core 2, lacto-N-fucopentaose 1 (LNFP1), VIRAL PROTEIN
Deposited on 2019-05-15, released 2019-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Outer capsid protein VP4
  Species: Rotavirus A [TaxId:28875]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E2EA82 (0-158)
    • expression tag (159-162)
  Domains in SCOPe 2.08: d6k2oa1, d6k2oa2
• Heterogens: NA, NAG, FUC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6k2oA (A:)
  ldgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfge
  nkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetprat
  tdssntanlndisiiihsefyiiprsqeskcneyinngllehh