PDB entry 6jqt

View 6jqt on RCSB PDB site
Description: Crystal structure of ordered Asn70 and Asn116 in native peptidyl t-RNA hydrolase from Acinetobacter baumannii at 1.80 Angstrom resolution.
Class: hydrolase
Keywords: hydrolase
Deposited on 2019-04-01, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (3-195)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d6jqta1, d6jqta2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jqtA (A:)
  gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
  hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
  lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
  gqvpqamnqinaykpa