PDB entry 6jlt

View 6jlt on RCSB PDB site
Description: The partially disordered conformation of ubiquitin (Q41N variant)
Class: structural protein
Keywords: protein, pressure, partially disordered conformation, structural protein
Deposited on 2019-03-06, released 2019-03-20
Made obsolete by 6k4i on 2019-10-30

The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot J3QS39 (0-75)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6jlta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jltA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqnrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg