PDB entry 6jkx

View 6jkx on RCSB PDB site
Description: Crystal structure of peptidyl-tRNA hydrolase with multiple sodium and chloride ions at 1.08 A resolution.
Class: hydrolase
Keywords: hydrolase
Deposited on 2019-03-03, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-tRNA hydrolase
  Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
  Gene: pth, HMPREF0010_01329
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0C9L6 (3-195)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d6jkxa1, d6jkxa2
• Heterogens: CL, MOH, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jkxA (A:)
  gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
  hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
  lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
  gqvpqamnqinaykpa