PDB entry 6j9u

View 6j9u on RCSB PDB site
Description: Complex structure of Lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2019-01-24, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9ua1, d6j9ua2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9ub1, d6j9ub2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9uc1, d6j9uc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9ud1, d6j9ud2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9ue1, d6j9ue2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed):
    • Uniprot S6C1Z0
      • engineered mutation (54-55)
      • engineered mutation (163)
      • engineered mutation (222-223)
    Domains in SCOPe 2.07: d6j9uf1, d6j9uf2
  • Heterogens: PYR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j9uA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uA (A:)
    itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
    kkiysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpv
    diltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgdtefpv
    wshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatalarisk
    ailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasq
    lkkvlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j9uB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uB (B:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6j9uC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uC (C:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6j9uD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uD (D:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6j9uE (E:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uE (E:)
    itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
    kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
    aanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehgd
    tefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiatal
    ariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmq
    ksasqlkkvltdafa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6j9uF (F:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9uF (F:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiakmvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrnkayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdafa