PDB entry 6j9t

View 6j9t on RCSB PDB site
Description: Complex structure of Lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2019-01-24, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9ta1, d6j9ta2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9tb1, d6j9tb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9tc1, d6j9tc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9td1, d6j9td2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9te1, d6j9te2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Lactobacillus casei subsp. casei ATCC 393 [TaxId:219334]
    Gene: ldh, LBCZ_2323
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j9tf1, d6j9tf2
  • Heterogens: SO4, FBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j9tA (A:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tA (A:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
    pkkiysaeysdakdadlvvitagapqtrldlvnknlkilksivdpivdsgfngiflvaan
    pvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtef
    pvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalari
    skailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksa
    sqlkkvltda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j9tB (B:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tB (B:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdafa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6j9tC (C:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tC (C:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
    pkkiysaeysdakdadlvvitagapqtrldlvnknlkilksivdpivdsgfngiflvaan
    pvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgdtef
    pvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatalari
    skailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksa
    sqlkkvltdaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6j9tD (D:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tD (D:)
    itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp
    kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
    aanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgd
    tefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiatal
    ariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmq
    ksasqlkkvltdaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6j9tE (E:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tE (E:)
    itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp
    kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
    aanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehgd
    tefpvwshaniggvtiaewvkedklvkmfedvrdaayeiiklkgatfygiatalariska
    ilndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesmqksasql
    kkvltdaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6j9tF (F:)
    masitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpf
    tspkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngi
    flvaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimge
    hgdtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygia
    talariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheee
    smqksasqlkkvltdafakndietrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j9tF (F:)
    sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
    pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
    vaanpvdiltyatwklsgfpknrvvgsgtsldtarfrqsiaemvnvdarsvhayimgehg
    dtefpvwshaniggvtiaewvkahpeikedklvkmfedvrdaayeiiklkgatfygiata
    lariskailndenavlplsvymdgqyglndiyigtpavinrngiqnileipltdheeesm
    qksasqlkkvltdafa