PDB entry 6j7c

View 6j7c on RCSB PDB site
Description: Crystal structure of proline racemase-like protein from Thermococcus litoralis in complex with proline
Class: isomerase
Keywords: Proline racemase, Hydroxyproline 2-epimerase, Hyperthermophilic archaea, ISOMERASE
Deposited on 2019-01-17, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline racemase
    Species: Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) [TaxId:523849]
    Gene: OCC_00372
    Database cross-references and differences (RAF-indexed):
    • Uniprot H3ZMH5 (14-343)
      • expression tag (13)
    Domains in SCOPe 2.07: d6j7ca1, d6j7ca2
  • Heterogens: PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j7cA (A:)
    mgsshhhhhhsqdlfadhvfhvvdthtegeptrivlsgvnvkgediiekreyfkehydwi
    rtallheprghsdqfgavlvpsdiadfgviymdtsgyldmcghatmgvatvlvelgiiek
    kepyttvkletpaglveakakvkggvvkevtvvdvpsfyvgefvieypgrgkikvdvafg
    gnfyviadardlglrvrreyikeliptalklikvaneqikvqhprkgvqnrinlamltde
    peredsdgknvviwgegsvdrspcgtgsasrvatlyskgilkegdifvhesilgtqfrik
    ivgttkigeytaiipeitgsayitkisqdiiskndplwkgfllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j7cA (A:)
    lfadhvfhvvdthtegeptrivlsgvnvkgediiekreyfkehydwirtallheprghsd
    qfgavlvpsdiadfgviymdtsgyldmcghatmgvatvlvelgiiekkepyttvkletpa
    glveakakvkggvvkevtvvdvpsfyvgefvieypgrgkikvdvafggnfyviadardlg
    lrvrreyikeliptalklikvaneqikvqhprkgvqnrinlamltdeperedsdgknvvi
    wgegsvdrspcgtgsasrvatlyskgilkegdifvhesilgtqfrikivgttkigeytai
    ipeitgsayitkisqdiiskndplwkgfllr