PDB entry 6j76

View 6j76 on RCSB PDB site
Description: Structure of 3,6-anhydro-L-galactose Dehydrogenase in Complex with NAP
Class: oxidoreductase
Keywords: Aldehyde Dehydrogenase, OXIDOREDUCTASE
Deposited on 2019-01-17, released 2020-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase A
    Species: Vibrio variabilis [TaxId:990271]
    Gene: JCM19239_2055
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j76a_
  • Chain 'B':
    Compound: Aldehyde dehydrogenase A
    Species: Vibrio variabilis [TaxId:990271]
    Gene: JCM19239_2055
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j76b_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j76A (A:)
    mkqyqmyvggewidasngqtepvvspineevlayiqdadasdaervlavattaqkewakq
    parqraevlrkfaqlirdnkqylaellvkeqgkllkvalgeveatstfieyacdwarqmd
    gdivksdnaneqimihkiprgvvvaitawnfplalagrkigpalvagnsivvkptsetpl
    atlelgylaeqagipagvlnivtgggrtlgnelvghrmtnmvsmtgstpagqsiirasan
    nmahvqlelggkapfivmedadleqaaaaalhsrfdncgqvctcnermyvhgavydefmr
    ifmgkveaikvgdpmdpasdmgpkvnanelahmeelvaeavdegatvlfggkklegpefe
    kgfwfeptvltnvtqdmtivheesfgpilpvikfdsfdevieyandsdyglaamictqnm
    hyinrlltelesgeiyvnrghgeqhqgfhngyklsgtggedgkygfeqylekktfyinyn
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j76A (A:)
    qyqmyvggewidasngqtepvvspineevlayiqdadasdaervlavattaqkewakqpa
    rqraevlrkfaqlirdnkqylaellvkeqgkllkvalgeveatstfieyacdwarqmdgd
    ivksdnaneqimihkiprgvvvaitawnfplalagrkigpalvagnsivvkptsetplat
    lelgylaeqagipagvlnivtgggrtlgnelvghrmtnmvsmtgstpagqsiirasannm
    ahvqlelggkapfivmedadleqaaaaalhsrfdncgqvctcnermyvhgavydefmrif
    mgkveaikvgdpmdpasdmgpkvnanelahmeelvaeavdegatvlfggkklegpefekg
    fwfeptvltnvtqdmtivheesfgpilpvikfdsfdevieyandsdyglaamictqnmhy
    inrlltelesgeiyvnrghgeqhqgfhngyklsgtggedgkygfeqylekktfyiny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j76B (B:)
    mkqyqmyvggewidasngqtepvvspineevlayiqdadasdaervlavattaqkewakq
    parqraevlrkfaqlirdnkqylaellvkeqgkllkvalgeveatstfieyacdwarqmd
    gdivksdnaneqimihkiprgvvvaitawnfplalagrkigpalvagnsivvkptsetpl
    atlelgylaeqagipagvlnivtgggrtlgnelvghrmtnmvsmtgstpagqsiirasan
    nmahvqlelggkapfivmedadleqaaaaalhsrfdncgqvctcnermyvhgavydefmr
    ifmgkveaikvgdpmdpasdmgpkvnanelahmeelvaeavdegatvlfggkklegpefe
    kgfwfeptvltnvtqdmtivheesfgpilpvikfdsfdevieyandsdyglaamictqnm
    hyinrlltelesgeiyvnrghgeqhqgfhngyklsgtggedgkygfeqylekktfyinyn
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j76B (B:)
    kqyqmyvggewidasngqtepvvspineevlayiqdadasdaervlavattaqkewakqp
    arqraevlrkfaqlirdnkqylaellvkeqgkllkvalgeveatstfieyacdwarqmdg
    divksdnaneqimihkiprgvvvaitawnfplalagrkigpalvagnsivvkptsetpla
    tlelgylaeqagipagvlnivtgggrtlgnelvghrmtnmvsmtgstpagqsiirasann
    mahvqlelggkapfivmedadleqaaaaalhsrfdncgqvctcnermyvhgavydefmri
    fmgkveaikvgdpmdpasdmgpkvnanelahmeelvaeavdegatvlfggkklegpefek
    gfwfeptvltnvtqdmtivheesfgpilpvikfdsfdevieyandsdyglaamictqnmh
    yinrlltelesgeiyvnrghgeqhqgfhngyklsgtggedgkygfeqylekktfyin