PDB entry 6j5f

View 6j5f on RCSB PDB site
Description: Complex structure of MAb 4.2-scFv with tick-borne encephalitis virus envelope protein Domain III
Class: viral protein/immune system
Keywords: protective and neutralizing antibody, flavivirus envelope protein, ANTIVIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2019-01-10, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Tick-borne encephalitis virus [TaxId:11084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j5fa_
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J5F (0-119)
    Domains in SCOPe 2.07: d6j5fh1, d6j5fh2
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6J5F (0-End)
    Domains in SCOPe 2.07: d6j5fl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j5fA (A:)
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqkgssigr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j5fA (A:)
    ytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnpt
    ienngggfiemqlppgdniiyvgelshqwfqkgs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j5fH (H:)
    qvqlqqsgpelvkpgasvkmsckasgytftdyvigwvkqrtgqglewigeiypgsgttyy
    nekfkdkatltadkssntaymqlssltsedsavyfcargedgyyialdywgqgttvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6j5fL (L:)
    dieltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvykaqtladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstppwtfgggtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j5fL (L:)
    dieltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvykaqtladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstppwtfgggtkleik