PDB entry 6j4k

View 6j4k on RCSB PDB site
Description: Structural basis for the target DNA recognition and binding by the MYB domain of phosphate starvation response 1
Class: transcription
Keywords: MYB domain, TRANSCRIPTION
Deposited on 2019-01-09, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PHOSPHATE STARVATION RESPONSE 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PHR1, At4g28610, T5F17.60
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j4ka_
  • Chain 'B':
    Compound: Protein PHOSPHATE STARVATION RESPONSE 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PHR1, At4g28610, T5F17.60
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6j4kb_
  • Heterogens: GOL, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6j4kA (A:)
    gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtaryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6j4kB (B:)
    gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtaryr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j4kB (B:)
    gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtar