PDB entry 6j23

View 6j23 on RCSB PDB site
Description: Crystal structure of arabidopsis ADAL complexed with GMP
Class: hydrolase
Keywords: m6A, N6-mAMP, arabidopsis, Zn, GMP, complex, deaminase, HYDROLASE
Deposited on 2018-12-30, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosine/AMP deaminase family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g04880, T4B21.20, T4B21_20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8LPL7 (0-End)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d6j23a_
  • Heterogens: 5GP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6j23A (A:)
    mewiqslpkielhahlngsirdstllelarvlgekgvivfadvehviqkndrslvevfkl
    fdlihklttdhktvtritrevvedfalenvvylelrttpkrsdsigmskrsymeaviqgl
    rsvsevdidfvtasdsqklhnagdgigrkkiyvrlllsidrrettesametvklalemrd
    vgvvgidlsgnplvgewstflpalqyakdndlhitlhcgevpnpkeiqamldfkphrigh
    acffkdedwtklksfripveicltsnivtksissidihhfadlynakhplilctndfgvf
    stslsneyalavrslglsksetfalaraaidatfaedevkqqlrfifdsaspehv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6j23A (A:)
    mewiqslpkielhahlngsirdstllelarvlgekgvivfadvehviqkndrslvevfkl
    fdlihklttdhktvtritrevvedfalenvvylelrttpkrsdsigmskrsymeaviqgl
    rsvsevdidfvrkkiyvrlllsidrrettesametvklalemrdvgvvgidlsgnplvge
    wstflpalqyakdndlhitlhcgevpnpkeiqamldfkphrighacffkdedwtklksfr
    ipveicltsnivtksissidihhfadlynakhplilctndfgvfstslsneyalavrslg
    lsksetfalaraaidatfaedevkqqlrfifdsaspeh