PDB entry 6ix6

View 6ix6 on RCSB PDB site
Description: Crystal structure of the complex of peptidyl-tRNA hydrolase with N-propanol at 1.43 A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-12-09, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0C9L6 (3-195)
      • expression tag (0-2)
      • engineered mutation (73)
    Domains in SCOPe 2.07: d6ix6a1, d6ix6a2
  • Heterogens: POL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ix6A (A:)
gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
hdvrlllpmtymnksgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
gqvpqamnqinaykpa