PDB entry 6iwt

View 6iwt on RCSB PDB site
Description: Crystal structure of methyltransferase COMT-S in P. praeruptorum
Class: transferase
Keywords: O-methyltransferase, O-methylation, evolution, TRANSFERASE
Deposited on 2018-12-06, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pmethyltransferase pCOMT-S
    Species: Peucedanum praeruptorum [TaxId:312531]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IWT
    Domains in SCOPe 2.07: d6iwta1, d6iwta2
  • Chain 'B':
    Compound: Pmethyltransferase pCOMT-S
    Species: Peucedanum praeruptorum [TaxId:312531]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IWT
    Domains in SCOPe 2.07: d6iwtb1, d6iwtb2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iwtA (A:)
    mtttelipptiqvdeeeeeacmfamqlasasvlpmvlksaieldllesiakagpgayvsp
    selaaklpssqpdtpvmldrilrllasysvlkckvqdlpqggverlyalapvckfltkns
    dgvsmaplllmnqdkilmeswyhlkdavldggipfnkaygmtafeyhgkdprfnkvfnlg
    msnhstitmkkilqtyngfaglktvvdvgggtgatlnmiiskypnikginfdlphvveda
    psypgvehvggdmfvsvpegdaifmkwichdwsdahclsflkncykalpqngkvilaeci
    lpeapdsklttknvihidvimlahnpggkertekefealgkmagfksfnkvccahntwim
    eflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iwtA (A:)
    eeeacmfamqlasasvlpmvlksaieldllesiakagpgayvspselaaklpssqpdtpv
    mldrilrllasysvlkckvqdlpqggverlyalapvckfltknsdgvsmaplllmnqdki
    lmeswyhlkdavldggipfnkaygmtafeyhgkdprfnkvfnlgmsnhstitmkkilqty
    ngfaglktvvdvgggtgatlnmiiskypnikginfdlphvvedapsypgvehvggdmfvs
    vpegdaifmkwichdwsdahclsflkncykalpqngkvilaecilpeapdsklttknvih
    idvimlahnpggkertekefealgkmagfksfnkvccahntwimef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iwtB (B:)
    mtttelipptiqvdeeeeeacmfamqlasasvlpmvlksaieldllesiakagpgayvsp
    selaaklpssqpdtpvmldrilrllasysvlkckvqdlpqggverlyalapvckfltkns
    dgvsmaplllmnqdkilmeswyhlkdavldggipfnkaygmtafeyhgkdprfnkvfnlg
    msnhstitmkkilqtyngfaglktvvdvgggtgatlnmiiskypnikginfdlphvveda
    psypgvehvggdmfvsvpegdaifmkwichdwsdahclsflkncykalpqngkvilaeci
    lpeapdsklttknvihidvimlahnpggkertekefealgkmagfksfnkvccahntwim
    eflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iwtB (B:)
    eeeacmfamqlasasvlpmvlksaieldllesiakagpgayvspselaaklpssqpdtpv
    mldrilrllasysvlkckvqdlpqggverlyalapvckfltknsdgvsmaplllmnqdki
    lmeswyhlkdavldggipfnkaygmtafeyhgkdprfnkvfnlgmsnhstitmkkilqty
    ngfaglktvvdvgggtgatlnmiiskypnikginfdlphvvedapsypgvehvggdmfvs
    vpegdaifmkwichdwsdahclsflkncykalpqngkvilaecilpeapdsklttknvih
    idvimlahnpggkertekefealgkmagfksfnkvccahntwimef